RAB3C (NM_138453) Human Recombinant Protein
CAT#: TP301436
Recombinant protein of human RAB3C, member RAS oncogene family (RAB3C), 20 µg
View other "RAB3C" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201436 protein sequence
Red=Cloning site Green=Tags(s) MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ NTRLKETPPPPQPNCAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612462 |
Locus ID | 115827 |
UniProt ID | Q96E17 |
Refseq Size | 1030 |
Cytogenetics | 5q11.2 |
Refseq ORF | 681 |
Summary | This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Novel antibodies reveal presynaptic localization of C9orf72 protein and reduced protein levels in C9orf72 mutation carriers
,Frick, P;Sellier, C;Mackenzie, IRA;Cheng, CY;Tahraoui-Bories, J;Martinat, C;Pasterkamp, RJ;Prudlo, J;Edbauer, D;Oulad-Abdelghani, M;Feederle, R;Charlet-Berguerand, N;Neumann, M;,
Acta Neuropathol Commun
,PubMed ID 30075745
[RAB3C]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408603 | RAB3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408603 | Transient overexpression lysate of RAB3C, member RAS oncogene family (RAB3C) |
CNY 3,080.00 |
|
PH301436 | RAB3C MS Standard C13 and N15-labeled recombinant protein (NP_612462) |
CNY 19,520.00 |