Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein
CAT#: TP301514
Recombinant protein of human pallidin homolog (mouse) (PLDN), 20 µg
View other "Pallidin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201514 protein sequence
Red=Cloning site Green=Tags(s) MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQA LQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQ QKRQKEELEREQQREKEFEREKQLTARPAKRM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036520 |
Locus ID | 26258 |
UniProt ID | Q9UL45, B3KY40 |
Refseq Size | 3959 |
Cytogenetics | 15q21.1 |
Refseq ORF | 516 |
Synonyms | BLOS6; HPS9; PA; PALLID; PLDN |
Summary | The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402203 | BLOC1S6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402203 | Transient overexpression lysate of pallidin homolog (mouse) (PLDN) |
CNY 3,080.00 |
|
PH301514 | PLDN MS Standard C13 and N15-labeled recombinant protein (NP_036520) |
CNY 19,520.00 |
其它Pallidin产品