TRA2B (NM_004593) Human Recombinant Protein
CAT#: TP301542
Recombinant protein of human transformer 2 beta homolog (Drosophila) (TRA2B), 20 µg
View other "TRA2B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201542 protein sequence
Red=Cloning site Green=Tags(s) MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS RSYSPRRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004584 |
Locus ID | 6434 |
UniProt ID | P62995 |
Refseq Size | 4290 |
Cytogenetics | 3q27.2 |
Refseq ORF | 864 |
Synonyms | Htra2-beta; PPP1R156; SFRS10; SRFS10; TRA2-BETA; TRAN2B |
Summary | This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401456 | TRA2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401456 | Transient overexpression lysate of transformer 2 beta homolog (Drosophila) (TRA2B) |
CNY 3,080.00 |
|
PH301542 | TRA2B MS Standard C13 and N15-labeled recombinant protein (NP_004584) |
CNY 19,520.00 |