United States
Germany
Japan
United Kingdom
China
FKBP2 (NM_057092) Human Recombinant Protein
CAT＃: TP301608
Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2, 20 µg
View other "FKBP2" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201608 protein sequence
Red=Cloning site Green=Tags(s) MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT EL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_476433 |
| Locus ID | 2286 |
| UniProt ID | P26885 |
| Refseq Size | 653 |
| Cytogenetics | 11q13.1 |
| Refseq ORF | 426 |
| Synonyms | FKBP-13; FKBP13; PPIase |
| Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401423 | FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403297 | FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427591 | FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401423 | Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 1 |
CNY 3,080.00 |
|
| LY403297 | Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2 |
CNY 3,080.00 |
|
| LY427591 | Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 3 |
CNY 3,080.00 |
|
| PH301608 | FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_476433) |
CNY 19,520.00 |
|
| PH310573 | FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004461) |
CNY 14,250.00 |
|
| PH325120 | FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128680) |
CNY 19,520.00 |
|
| TP310573 | Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP325120 | Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP721091 | Purified recombinant protein of Human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2 |
CNY 1,800.00 |
