CIRBP (NM_001280) Human Recombinant Protein
CAT#: TP301639
Recombinant protein of human cold inducible RNA binding protein (CIRBP), transcript variant 1, 20 µg
View other "CIRBP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 4 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201639 protein sequence
Red=Cloning site Green=Tags(s) MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001271 |
Locus ID | 1153 |
UniProt ID | Q14011 |
Refseq Size | 1397 |
Cytogenetics | 19p13.3 |
Refseq ORF | 516 |
Synonyms | CIRP |
Summary | Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3' UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.[UniProtKB/Swiss-Prot Function] |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
Extracellular CIRP Activates the IL-6Rα/STAT3/Cdk5 Pathway in Neurons
,Sharma, A;Brenner, M;Jacob, A;Marambaud, P;Wang, P;,
Molecular neurobiology
,PubMed ID 33783711
[CIRBP]
|
Deficiency of cold-inducible RNA-binding protein exacerbated monocrotaline-induced pulmonary artery hypertension through Caveolin1 and CAVIN1
,Liu, J;Ke, X;Wang, L;Zhang, Y;Yang, J;,
Journal of cellular and molecular medicine
,PubMed ID 33755319
[CIRBP]
|
A common intronic variant of PARP1 confers melanoma risk and mediates melanocyte growth via regulation of MITF.
,null,
Nature genetics
,PubMed ID 28759004
[CIRBP]
|
Cold-inducible RNA-binding protein (CIRP) triggers inflammatory responses in hemorrhagic shock and sepsis
,Qiang, X;Yang, WL;Wu, R;Zhou, M;Jacob, A;Dong, W;Kuncewitch, M;Ji, Y;Yang, H;Wang, H;Fujita, J;Nicastro, J;Coppa, GF;Tracey, KJ;Wang, P;,
J. Bacteriol., Aug 2013; 195: 3468 - 3475.
,PubMed ID 24097189
[CIRBP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420029 | CIRBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420029 | Transient overexpression lysate of cold inducible RNA binding protein (CIRBP), transcript variant 1 |
CNY 3,080.00 |
|
PH301639 | CIRBP MS Standard C13 and N15-labeled recombinant protein (NP_001271) |
CNY 19,520.00 |