RAD18 (NM_020165) Human Recombinant Protein
CAT#: TP301700
Recombinant protein of human RAD18 homolog (S. cerevisiae) (RAD18), 20 µg
View other "RAD18" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201700 protein sequence
Red=Cloning site Green=Tags(s) MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEP DLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIRE MSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVN IPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQE FVHMYNAQCDALHPKSAAEIVQEIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEF QLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREED SSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRN KRNRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro protein binding assay (PMID: 25961918) |
Reference Data | |
RefSeq | NP_064550 |
Locus ID | 56852 |
UniProt ID | Q9NS91 |
Refseq Size | 5739 |
Cytogenetics | 3p25.3 |
Refseq ORF | 1485 |
Synonyms | RNF73 |
Summary | The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
USP7 is essential for maintaining Rad18 stability and DNA damage tolerance
,Zlatanou, A;Sabbioneda, S;Miller, ES;Greenwalt, A;Aggathanggelou, A;Maurice, MM;Lehmann, AR;Stankovic, T;Reverdy, C;Colland, F;Vaziri, C;Stewart, GS;,
Oncogene
,PubMed ID 25961918
[RAD18]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402768 | RAD18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402768 | Transient overexpression lysate of RAD18 homolog (S. cerevisiae) (RAD18) |
CNY 3,080.00 |
|
PH301700 | RAD18 MS Standard C13 and N15-labeled recombinant protein (NP_064550) |
CNY 19,520.00 |