PDIA6 (NM_005742) Human Recombinant Protein
CAT#: TP301710
Recombinant protein of human protein disulfide isomerase family A, member 6 (PDIA6), 20 µg
View other "PDIA6" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201710 protein sequence
Red=Cloning site Green=Tags(s) MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAAT ALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG GRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ TKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLE IINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALG IGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP VEDDIDLSDVELDDLGKDEL TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 47.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005733 |
Locus ID | 10130 |
UniProt ID | Q15084 |
Refseq Size | 2349 |
Cytogenetics | 2p25.1 |
Refseq ORF | 1320 |
Synonyms | ERP5; P5; TXNDC7 |
Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. This protein inhibits the aggregation of misfolded proteins and exhibits both isomerase and chaperone activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Tumor-associated autoantibodies from mouse breast cancer models are found in serum of breast cancer patients
,Stanton, S;Gad, E;Ramos, E;Corulli, L;Annis, J;Childs, J;Katayama, H;Hanash, S;Marks, J;Disis, M;,
npj Breast Cancer
,PubMed ID 33976232
[PDIA6]
|
Protein disulfide isomerase plasma levels in healthy humans reveal proteomic signatures involved in contrasting endothelial phenotypes
,de Oliveira, PVS;Garcia-Rosa, S;Sachetto, ATA;,
Redox Biology
,PubMed ID 30870787
[PDIA6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401760 | PDIA6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401760 | Transient overexpression lysate of protein disulfide isomerase family A, member 6 (PDIA6) |
CNY 3,080.00 |
|
PH301710 | PDIA6 MS Standard C13 and N15-labeled recombinant protein (NP_005733) |
CNY 19,520.00 |
|
TP720679 | Purified recombinant protein of Human protein disulfide isomerase family A, member 6 (PDIA6) |
CNY 3,140.00 |