NUP37 (NM_024057) Human Recombinant Protein
CAT#: TP301720
Recombinant protein of human nucleoporin 37kDa (NUP37), 20 µg
View other "NUP37" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201720 protein sequence
Red=Cloning site Green=Tags(s) MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEGIQYKTLRTFH HGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEI ASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLLAQQAILSLESEQVP LMSAHWCLKNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQF QIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076962 |
Locus ID | 79023 |
UniProt ID | Q8NFH4 |
Refseq Size | 1228 |
Cytogenetics | 12q23.2 |
Refseq ORF | 978 |
Synonyms | MCPH24; p37 |
Summary | Nuclear pore complexes (NPCs) are used for transporting macromolecules between the cytoplasm and the nucleus. NPCs consist of multiple copies of 30 distinct proteins (nucleoporins), which assemble into biochemically-separable subcomplexes. The protein encoded by this gene is part of a subcomplex (Nup107-160) that is required for proper NPC function as well as for normal kinetochore-microtubule interaction and mitosis. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411376 | NUP37 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411376 | Transient overexpression lysate of nucleoporin 37kDa (NUP37) |
CNY 3,080.00 |
|
PH301720 | NUP37 MS Standard C13 and N15-labeled recombinant protein (NP_076962) |
CNY 19,520.00 |
|
TP761508 | Purified recombinant protein of Human nucleoporin 37kDa (NUP37), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |