MPP1 (NM_002436) Human Recombinant Protein
CAT#: TP301754
Recombinant protein of human membrane protein, palmitoylated 1, 55kDa (MPP1), 20 µg
View other "MPP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201754 protein sequence
Red=Cloning site Green=Tags(s) MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVR LIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKET KGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGS SKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF KRKTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLE FGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSE AIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSPQWVPVSWVY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002427 |
Locus ID | 4354 |
UniProt ID | Q00013 |
Refseq Size | 2067 |
Cytogenetics | Xq28 |
Refseq ORF | 1398 |
Synonyms | AAG12; DXS552E; EMP55; MRG1; PEMP |
Summary | This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419325 | MPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433095 | MPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433103 | MPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419325 | Transient overexpression lysate of membrane protein, palmitoylated 1, 55kDa (MPP1), transcript variant 1 |
CNY 3,080.00 |
|
LY433095 | Transient overexpression lysate of membrane protein, palmitoylated 1, 55kDa (MPP1), transcript variant 3 |
CNY 3,080.00 |
|
LY433103 | Transient overexpression lysate of membrane protein, palmitoylated 1, 55kDa (MPP1), transcript variant 2 |
CNY 3,080.00 |
|
PH301754 | MPP1 MS Standard C13 and N15-labeled recombinant protein (NP_002427) |
CNY 19,520.00 |