BMX (NM_203281) Human Recombinant Protein
CAT#: TP302002
Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202002 protein sequence
Red=Cloning site Green=Tags(s) MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE QTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAA PGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSS TSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP ESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYH VHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTE YISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHR LYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 77.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_975010 |
Locus ID | 660 |
UniProt ID | P51813 |
Refseq Size | 2592 |
Cytogenetics | Xp22.2 |
Refseq ORF | 2025 |
Synonyms | ETK; PSCTK2; PSCTK3 |
Summary | This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyrosine-phosphorylated proteins and functions in signal transduction. The protein is implicated in several signal transduction pathways including the Stat pathway, and regulates differentiation and tumorigenicity of several types of cancer cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400648 | BMX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404365 | BMX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400648 | Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 2 |
CNY 3,080.00 |
|
LY404365 | Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 1 |
CNY 3,080.00 |
|
PH302002 | BMX MS Standard C13 and N15-labeled recombinant protein (NP_975010) |
CNY 19,520.00 |
|
PH321915 | BMX MS Standard C13 and N15-labeled recombinant protein (NP_001712) |
CNY 19,520.00 |
|
TP321915 | Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 2, 20 µg |
CNY 2,900.00 |