FKBP25 (FKBP3) (NM_002013) Human Recombinant Protein
CAT#: TP302200
Recombinant protein of human FK506 binding protein 3, 25kDa (FKBP3), 20 µg
View other "FKBP25" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202200 protein sequence
Red=Cloning site Green=Tags(s) MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP NAKLTFEVELVDID myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002004 |
Locus ID | 2287 |
UniProt ID | Q00688 |
Refseq Size | 1353 |
Cytogenetics | 14q21.2 |
Refseq ORF | 672 |
Synonyms | FKBP-3; FKBP-25; FKBP25; PPIase |
Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400736 | FKBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400736 | Transient overexpression lysate of FK506 binding protein 3, 25kDa (FKBP3) |
CNY 3,080.00 |
|
PH302200 | FKBP3 MS Standard C13 and N15-labeled recombinant protein (NP_002004) |
CNY 19,520.00 |
|
TP721192 | Purified recombinant protein of Human FK506 binding protein 3, 25kDa (FKBP3) |
CNY 3,140.00 |