CPVL (NM_031311) Human Recombinant Protein
CAT#: TP302336
Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1, 20 µg
View other "CPVL" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202336 protein sequence
Red=Cloning site Green=Tags(s) MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK IFKSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112601 |
Locus ID | 54504 |
UniProt ID | Q9H3G5 |
Refseq Size | 1691 |
Cytogenetics | 7p14.3 |
Refseq ORF | 1428 |
Synonyms | HVLP |
Summary | The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410561 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412799 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410561 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 |
CNY 3,080.00 |
|
LY412799 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2 |
CNY 3,080.00 |
|
PH302336 | CPVL MS Standard C13 and N15-labeled recombinant protein (NP_112601) |
CNY 19,520.00 |
|
PH320622 | CPVL MS Standard C13 and N15-labeled recombinant protein (NP_061902) |
CNY 19,520.00 |
|
TP320622 | Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP721099 | Purified recombinant protein of Human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 |
CNY 1,800.00 |