BLOC1S2 (NM_001001342) Human Recombinant Protein
CAT#: TP302351L
Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 2 (BLOC1S2), transcript variant 2, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202351 protein sequence
Red=Cloning site Green=Tags(s) MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEE QVAALEQAAYKLDAYSKKLEAKYKKLEKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001001342 |
Locus ID | 282991 |
UniProt ID | Q6QNY1 |
Refseq Size | 2722 |
Cytogenetics | 10q24.31 |
Refseq ORF | 297 |
Synonyms | BLOS2; BORCS2; CEAP; CEAP11 |
Summary | This gene encodes a protein with multiple functions. The encoded protein has been found in association with the centrosome, shown to co-localize with gamma-tubulin, and also found to be one of the proteins in the BLOC-1 complex which functions in the formation of lysosome-related organelles. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Documents
FAQs |
SDS |
其它BLOC1S2产品