LSM6 (NM_007080) Human Recombinant Protein
CAT#: TP302373
Recombinant protein of human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), 20 µg
View other "LSM6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202373 protein sequence
Red=Cloning site Green=Tags(s) MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV LYISTQKRRM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009011 |
Locus ID | 11157 |
UniProt ID | P62312 |
Refseq Size | 789 |
Cytogenetics | 4q31.22 |
Refseq ORF | 240 |
Synonyms | YDR378C |
Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation, Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416217 | LSM6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416217 | Transient overexpression lysate of LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6) |
CNY 3,080.00 |
|
PH302373 | LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011) |
CNY 19,520.00 |