United States
Germany
Japan
United Kingdom
China
CITED1 (NM_004143) Human Recombinant Protein
CAT＃: TP302419
Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1, 20 µg
View other "CITED1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202419 protein sequence
Red=Cloning site Green=Tags(s) MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG SPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004134 |
| Locus ID | 4435 |
| UniProt ID | Q99966 |
| Refseq Size | 1251 |
| Cytogenetics | Xq13.1 |
| Refseq ORF | 579 |
| Synonyms | MSG1 |
| Summary | This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418187 | CITED1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428546 | CITED1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428547 | CITED1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418187 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1 |
CNY 3,080.00 |
|
| LY428546 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3 |
CNY 3,080.00 |
|
| LY428547 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4 |
CNY 3,080.00 |
|
| PH302419 | CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_004134) |
CNY 14,250.00 |
|
| PH327378 | CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138358) |
CNY 14,250.00 |
|
| PH327383 | CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138359) |
CNY 14,250.00 |
|
| TP327378 | Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP327383 | Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4, 20 µg |
CNY 2,900.00 |
