Follistatin (FST) (NM_013409) Human Recombinant Protein
CAT#: TP302523
Recombinant protein of human follistatin (FST), transcript variant FST344, 20 µg
View other "Follistatin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202523 protein sequence
Red=Cloning site Green=Tags(s) MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDV NDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYR NECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGND GVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSD EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037541 |
Locus ID | 10468 |
UniProt ID | P19883, A0A024QZU6 |
Refseq Size | 1834 |
Cytogenetics | 5q11.2 |
Refseq ORF | 1032 |
Synonyms | FS |
Summary | Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415607 | FST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416705 | FST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415607 | Transient overexpression lysate of follistatin (FST), transcript variant FST344 |
CNY 3,080.00 |
|
LY416705 | Transient overexpression lysate of follistatin (FST), transcript variant FST317 |
CNY 3,080.00 |
|
PH302523 | FST MS Standard C13 and N15-labeled recombinant protein (NP_037541) |
CNY 19,520.00 |
|
PH315777 | FST MS Standard C13 and N15-labeled recombinant protein (NP_006341) |
CNY 19,520.00 |
|
TP315777 | Recombinant protein of human follistatin (FST), transcript variant FST317, 20 µg |
CNY 2,900.00 |
其它Follistatin产品