RPRM (NM_019845) Human Recombinant Protein
CAT#: TP302634
Recombinant protein of human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), 20 µg
View other "RPRM" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202634 protein sequence
Red=Cloning site Green=Tags(s) MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062819 |
Locus ID | 56475 |
UniProt ID | Q9NS64 |
Refseq Size | 1496 |
Cytogenetics | 2q23.3 |
Refseq ORF | 327 |
Synonyms | REPRIMO |
Summary | May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412715 | RPRM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412715 | Transient overexpression lysate of reprimo, TP53 dependent G2 arrest mediator candidate (RPRM) |
CNY 3,080.00 |
|
PH302634 | RPRM MS Standard C13 and N15-labeled recombinant protein (NP_062819) |
CNY 19,520.00 |