TNFAIP8 (NM_014350) Human Recombinant Protein
CAT#: TP302729
Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg
View other "TNFAIP8" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202729 protein sequence
Red=Cloning site Green=Tags(s) MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055165 |
Locus ID | 25816 |
UniProt ID | O95379 |
Refseq Size | 2103 |
Cytogenetics | 5q23.1 |
Refseq ORF | 594 |
Synonyms | GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2 |
Summary | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402318 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421470 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425876 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402318 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 |
CNY 3,080.00 |
|
LY421470 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 |
CNY 3,080.00 |
|
PH302729 | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) |
CNY 19,520.00 |
|
PH320669 | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122) |
CNY 14,250.00 |
|
TP320669 | Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它TNFAIP8产品