Renalase (RNLS) (NM_001031709) Human Recombinant Protein
CAT#: TP302791
Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 1, 20 µg
View other "Renalase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202791 protein sequence
Red=Cloning site Green=Tags(s) MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYA KKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDD KWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPW AGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQP IATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026879 |
Locus ID | 55328 |
UniProt ID | Q5VYX0 |
Refseq Size | 2420 |
Cytogenetics | 10q23.31 |
Refseq ORF | 1026 |
Synonyms | C10orf59; RENALASE |
Summary | Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).[supplied by OMIM, Mar 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413115 | RNLS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422160 | RNLS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413115 | Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 2 |
CNY 3,080.00 |
|
LY422160 | Transient overexpression lysate of renalase, FAD-dependent amine oxidase (RNLS), transcript variant 1 |
CNY 3,080.00 |
|
PH302791 | RNLS MS Standard C13 and N15-labeled recombinant protein (NP_001026879) |
CNY 19,520.00 |
|
PH320551 | RNLS MS Standard C13 and N15-labeled recombinant protein (NP_060833) |
CNY 19,520.00 |
|
TP320551 | Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Renalase产品