SIRT6 (NM_016539) Human Recombinant Protein
CAT#: TP302833
Recombinant protein of human sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) (SIRT6), 20 µg
View other "SIRT6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202833 protein sequence
Red=Cloning site Green=Tags(s) MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGV WTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEE CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLS ITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPR VLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKA KAVPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057623 |
Locus ID | 51548 |
UniProt ID | Q8N6T7 |
Refseq Size | 1657 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1065 |
Synonyms | SIR2L6 |
Summary | This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase and histone deacetylase activities, and plays a role in DNA repair, maintenance of telomeric chromatin, inflammation, lipid and glucose metabolism. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402563 | SIRT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402563 | Transient overexpression lysate of sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) (SIRT6) |
CNY 3,080.00 |
|
PH302833 | SIRT6 MS Standard C13 and N15-labeled recombinant protein (NP_057623) |
CNY 19,520.00 |