FOXO3 (NM_201559) Human Recombinant Protein
CAT#: TP302894
Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 2, 20 µg
View other "FOXO3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202894 representing NM_201559
Red=Cloning site Green=Tags(s) MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Co-immunoprecipitation (PMID: 27428650) |
Reference Data | |
RefSeq | NP_963853 |
Locus ID | 2309 |
UniProt ID | O43524 |
Refseq Size | 3311 |
Cytogenetics | 6q21 |
Refseq ORF | 2019 |
Synonyms | AF6q21; FKHRL1; FKHRL1P2; FOXO2; FOXO3A |
Summary | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Chemokine signaling pathway, Endometrial cancer, Neurotrophin signaling pathway, Non-small cell lung cancer |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Histone deacetylase 3 associates with MeCP2 to regulate FOXO and social behavior
,Nott, A;Cheng, J;Gao, F;Lin, YT;Gjoneska, E;Ko, T;Minhas, P;Zamudio, AV;Meng, J;Zhang, F;Jin, P;Tsai, LH;,
Nat. Neurosci.
,PubMed ID 27428650
[FOXO3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400566 | FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404461 | FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400566 | Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 1 |
CNY 3,080.00 |
|
LY404461 | Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 2 |
CNY 3,080.00 |
|
PH302894 | FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_963853) |
CNY 19,520.00 |
|
PH309846 | FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_001446) |
CNY 19,520.00 |
|
TP309846 | Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 1, 20 µg |
CNY 2,900.00 |