UFD1 (NM_005659) Human Recombinant Protein
CAT#: TP302989
Recombinant protein of human ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 1, 20 µg
View other "UFD1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202989 protein sequence
Red=Cloning site Green=Tags(s) MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLT NKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKA VLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST EGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKK VEEDEAGGRFVAFSGEGQSLRKKGRKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005650 |
Locus ID | 7353 |
UniProt ID | Q92890 |
Refseq Size | 1783 |
Cytogenetics | 22q11.21 |
Refseq ORF | 921 |
Synonyms | UFD1L |
Summary | The protein encoded by this gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18. [provided by RefSeq, Jun 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417150 | UFD1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422127 | UFD1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417150 | Transient overexpression lysate of ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 1 |
CNY 3,080.00 |
|
LY422127 | Transient overexpression lysate of ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 2 |
CNY 3,080.00 |
|
PH302989 | UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_005650) |
CNY 19,520.00 |
|
PH313180 | UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_001030324) |
CNY 19,520.00 |
|
TP313180 | Recombinant protein of human ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 2, 20 µg |
CNY 2,900.00 |