IRAK4 (NM_016123) Human Recombinant Protein
CAT#: TP303041
Recombinant protein of human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2, 20 µg
View other "IRAK4" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203041 protein sequence
Red=Cloning site Green=Tags(s) MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057207 |
Locus ID | 51135 |
UniProt ID | Q9NWZ3, Q69FE3, B2RAP9, B4E359 |
Refseq Size | 4303 |
Cytogenetics | 12q12 |
Refseq ORF | 1380 |
Synonyms | IMD67; IPD1; IRAK-4; NY-REN-64; REN64 |
Summary | This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402503 | IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426473 | IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402503 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2 |
CNY 3,080.00 |
|
LY426473 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1 |
CNY 3,080.00 |
|
PH303041 | IRAK4 MS Standard C13 and N15-labeled recombinant protein (NP_057207) |
CNY 19,520.00 |
|
TP761970 | Purified recombinant protein of Human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,050.00 |