PI3 (NM_002638) Human Recombinant Protein
CAT#: TP303136
Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203136 protein sequence
Red=Cloning site Green=Tags(s) MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002629 |
Locus ID | 5266 |
UniProt ID | P19957 |
Refseq Size | 579 |
Cytogenetics | 20q13.12 |
Refseq ORF | 351 |
Synonyms | cementoin; ESI; SKALP; WAP3; WFDC14 |
Summary | This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
High Serum Elafin Prediction of Poor Prognosis of Locoregional Esophageal Squamous Cell Carcinoma
,Wu, I;Wang, Y;Chen, Y;Wu, C;Wu, M;Chen, W;Wang, W;Lin, H;Chen, C;Chou, S;Liu, Y;Wu, M;,
Cancers
,PubMed ID 34205756
[PI3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400936 | PI3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400936 | Transient overexpression lysate of peptidase inhibitor 3, skin-derived (PI3) |
CNY 3,080.00 |
|
PH303136 | PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629) |
CNY 19,520.00 |
|
TP720751 | Purified recombinant protein of Human peptidase inhibitor 3, skin-derived (PI3) |
CNY 3,140.00 |