PCTP L (STARD10) (NM_006645) Human Recombinant Protein
CAT#: TP303228
Recombinant protein of human StAR-related lipid transfer (START) domain containing 10 (STARD10), 20 µg
View other "PCTP L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203228 protein sequence
Red=Cloning site Green=Tags(s) MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKC RMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMG ADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPK AMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAG GEGSDDDTSLT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006636 |
Locus ID | 10809 |
UniProt ID | Q9Y365 |
Refseq Size | 1988 |
Cytogenetics | 11q13.4 |
Refseq ORF | 873 |
Synonyms | CGI-52; NY-CO-28; PCTP2; SDCCAG28 |
Summary | May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416482 | STARD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416482 | Transient overexpression lysate of StAR-related lipid transfer (START) domain containing 10 (STARD10) |
CNY 3,080.00 |
|
PH303228 | STARD10 MS Standard C13 and N15-labeled recombinant protein (NP_006636) |
CNY 19,520.00 |