Melanoma Inhibitory Activity (MIA) (NM_006533) Human Recombinant Protein
CAT#: TP303245
Recombinant protein of human melanoma inhibitory activity (MIA), 20 µg
View other "Melanoma Inhibitory Activity" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203245 protein sequence
Red=Cloning site Green=Tags(s) MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006524 |
Locus ID | 8190 |
UniProt ID | Q16674, A0A024R0P1 |
Refseq Size | 654 |
Cytogenetics | 19q13.2 |
Refseq ORF | 393 |
Synonyms | CD-RAP |
Summary | Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401957 | MIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401957 | Transient overexpression lysate of melanoma inhibitory activity (MIA) |
CNY 3,080.00 |
|
PH303245 | MIA MS Standard C13 and N15-labeled recombinant protein (NP_006524) |
CNY 19,520.00 |
|
TP720129 | Recombinant protein of human melanoma inhibitory activity (MIA) |
CNY 3,140.00 |
其它Melanoma Inhibitory Activity产品