LSM5 (NM_012322) Human Recombinant Protein
CAT#: TP303266
Recombinant protein of human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, 20 µg
View other "LSM5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203266 protein sequence
Red=Cloning site Green=Tags(s) MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD QILLNGNNITMLVPGGEGPEV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036454 |
Locus ID | 23658 |
UniProt ID | Q9Y4Y9, A0A090N8Y5 |
Refseq Size | 2275 |
Cytogenetics | 7p14.3 |
Refseq ORF | 273 |
Synonyms | YER146W |
Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation, Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415800 | LSM5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415800 | Transient overexpression lysate of LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1 |
CNY 3,080.00 |
|
PH303266 | LSM5 MS Standard C13 and N15-labeled recombinant protein (NP_036454) |
CNY 19,520.00 |