UBE2B (NM_003337) Human Recombinant Protein
CAT#: TP303306
Recombinant protein of human ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B), 20 µg
View other "UBE2B" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203306 representing NM_003337
Red=Cloning site Green=Tags(s) MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTV RFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR VSAIVEQSWNDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003328 |
Locus ID | 7320 |
UniProt ID | P63146 |
Refseq Size | 2631 |
Cytogenetics | 5q31.1 |
Refseq ORF | 456 |
Synonyms | E2-17kDa; HHR6B; HR6B; RAD6B; UBC2 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418755 | UBE2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418755 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B) |
CNY 3,080.00 |
|
PH303306 | UBE2B MS Standard C13 and N15-labeled recombinant protein (NP_003328) |
CNY 19,520.00 |
|
TP720719 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B) |
CNY 3,140.00 |
|
TP720915 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B) |
CNY 3,140.00 |