SLD5 (GINS4) (NM_032336) Human Recombinant Protein
CAT#: TP303336
Recombinant protein of human GINS complex subunit 4 (Sld5 homolog) (GINS4), 20 µg
View other "SLD5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203336 protein sequence
Red=Cloning site Green=Tags(s) MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT IAPLVASGAVQLI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115712 |
Locus ID | 84296 |
UniProt ID | Q9BRT9 |
Refseq Size | 3841 |
Cytogenetics | 8p11.21 |
Refseq ORF | 669 |
Synonyms | SLD5 |
Summary | The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403156 | GINS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403156 | Transient overexpression lysate of GINS complex subunit 4 (Sld5 homolog) (GINS4) |
CNY 3,080.00 |
|
PH303336 | GINS4 MS Standard C13 and N15-labeled recombinant protein (NP_115712) |
CNY 19,520.00 |