XTP4 (MIEN1) (NM_032339) Human Recombinant Protein
CAT#: TP303346M
Recombinant protein of human chromosome 17 open reading frame 37 (C17orf37), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203346 protein sequence
Red=Cloning site Green=Tags(s) MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115715 |
Locus ID | 84299 |
UniProt ID | Q9BRT3 |
Refseq Size | 781 |
Cytogenetics | 17q12 |
Refseq ORF | 345 |
Synonyms | C17orf37; C35; ORB3; RDX12; XTP4 |
Summary | Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |