Tuftelin 1 (TUFT1) (NM_020127) Human Recombinant Protein
CAT#: TP303420
Recombinant protein of human tuftelin 1 (TUFT1), transcript variant 1, 20 µg
View other "Tuftelin 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203420 protein sequence
Red=Cloning site Green=Tags(s) MNGTRNWCTLVDVHPEDQAAGSVDILRLTLQGELTGDELEHIAQKAGRKTYAMVSSHSAGHSLASELVES HDGHEEIIKVYLKGRSGDKMIHEKNINQLKSEVQYIQEARNCLQKLREDISSKLDRNLGDSLHRQEIQVV LEKPNGFSQSPTALYSSPPEVDTCINEDVESLRKTVQDLLAKLQEAKRQHQSDCVAFEVTLSRYQREAEQ SNVALQREEDRVEQKEAEVGELQRRLLGMETEHQALLAKVREGEVALEELRSNNADCQAEREKAATLEKE VAGLREKIHHLDDMLKSQQRKVRQMIEQLQNSKAVIQSKDATIQELKEKIAYLEAENLEMHDRMEHLIEK QISHGNFSTQARAKTENPGSIRISKPPSPKPMPVIRVVET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064512 |
Locus ID | 7286 |
UniProt ID | Q9NNX1 |
Refseq Size | 3127 |
Cytogenetics | 1q21.3 |
Refseq ORF | 1170 |
Summary | Tuftelin is an acidic protein that is thought to play a role in dental enamel mineralization and is implicated in caries susceptibility. It is also thought to be involved with adaptation to hypoxia, mesenchymal stem cell function, and neurotrophin nerve growth factor mediated neuronal differentiation. [provided by RefSeq, Aug 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412667 | TUFT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426678 | TUFT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412667 | Transient overexpression lysate of tuftelin 1 (TUFT1), transcript variant 1 |
CNY 3,080.00 |
|
LY426678 | Transient overexpression lysate of tuftelin 1 (TUFT1), transcript variant 2 |
CNY 3,080.00 |
|
PH303420 | TUFT1 MS Standard C13 and N15-labeled recombinant protein (NP_064512) |
CNY 19,520.00 |
其它Tuftelin 1产品