BRMS1 (NM_015399) Human Recombinant Protein
CAT#: TP303428
Recombinant protein of human breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1, 20 µg
View other "BRMS1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203428 protein sequence
Red=Cloning site Green=Tags(s) MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056214 |
Locus ID | 25855 |
UniProt ID | Q9HCU9 |
Refseq Size | 1455 |
Cytogenetics | 11q13.2 |
Refseq ORF | 738 |
Summary | This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414569 | BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422568 | BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425471 | BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414569 | Transient overexpression lysate of breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1 |
CNY 3,080.00 |
|
LY422568 | Transient overexpression lysate of breast cancer metastasis suppressor 1 (BRMS1), transcript variant 2 |
CNY 3,080.00 |
|
PH303428 | BRMS1 MS Standard C13 and N15-labeled recombinant protein (NP_056214) |
CNY 19,520.00 |