PNO1 (NM_020143) Human Recombinant Protein
CAT#: TP303434
Recombinant protein of human partner of NOB1 homolog (S. cerevisiae) (PNO1), 20 µg
View other "PNO1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203434 protein sequence
Red=Cloning site Green=Tags(s) MESEMETQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVFPPLCGDGLLS GKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRTCKETKDVSALTKAADFVKAF ILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAIGRIAGKGGKTKFTIENVTRTRIVLADVKVH ILGSFQNIKMARTAICNLILGNPPSKVYGNIRAVASRSADRF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064528 |
Locus ID | 56902 |
UniProt ID | Q9NRX1 |
Refseq Size | 1994 |
Cytogenetics | 2p14 |
Refseq ORF | 756 |
Synonyms | KHRBP1; RRP20 |
Summary | Positively regulates dimethylation of two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA (PubMed:25851604).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412632 | PNO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412632 | Transient overexpression lysate of partner of NOB1 homolog (S. cerevisiae) (PNO1) |
CNY 3,080.00 |
|
PH303434 | PNO1 MS Standard C13 and N15-labeled recombinant protein (NP_064528) |
CNY 19,520.00 |