United States
Germany
Japan
United Kingdom
China
STAR (NM_000349) Human Recombinant Protein
CAT＃: TP303803
Purified recombinant protein of Homo sapiens steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "STAR" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203803 protein sequence
Red=Cloning site Green=Tags(s) MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLGSRLEETLYSD QELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVER MEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGMATDFGNMP EQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA SEARC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000340 |
| Locus ID | 6770 |
| UniProt ID | P49675, Q6IBK0 |
| Refseq Size | 2695 |
| Cytogenetics | 8p11.23 |
| Refseq ORF | 855 |
| Synonyms | STARD1 |
| Summary | The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423465 | STAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424767 | STAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425216 | STAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423465 | Transient overexpression lysate of steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
| LY424767 | Transient overexpression lysate of steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
| PH303803 | STAR MS Standard C13 and N15-labeled recombinant protein (NP_000340) |
CNY 14,250.00 |
|
| PH313299 | STAR MS Standard C13 and N15-labeled recombinant protein (NP_001007244) |
CNY 14,250.00 |
|
| TP313299 | Purified recombinant protein of Homo sapiens steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761908 | Purified recombinant protein of Human steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
STAR Rabbit Polyclonal Antibody
热销推荐
