NORE1 (RASSF5) (NM_182665) Human Recombinant Protein
CAT#: TP303854M
Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203854 protein sequence
Red=Cloning site Green=Tags(s) MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREK NCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHIS STTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENE TGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872606 |
Locus ID | 83593 |
UniProt ID | Q8WWW0 |
Refseq Size | 3531 |
Cytogenetics | 1q32.1 |
Refseq ORF | 795 |
Synonyms | Maxp1; NORE1; NORE1A; NORE1B; RAPL; RASSF3 |
Summary | This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Leukocyte transendothelial migration, Non-small cell lung cancer, Pathways in cancer |
Documents
FAQs |
SDS |