NEU4 (NM_080741) Human Recombinant Protein
CAT#: TP303948
Recombinant protein of human sialidase 4 (NEU4), 20 µg
View other "NEU4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203948 protein sequence
Red=Cloning site Green=Tags(s) MMSSAAFPRWLSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRR GTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVA SRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSF AFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVAS LPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQ PRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTE PWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPR GCCWPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 29118338) |
Reference Data | |
RefSeq | NP_542779 |
Locus ID | 129807 |
UniProt ID | Q8WWR8, Q3KR05 |
Refseq Size | 2373 |
Cytogenetics | 2q37.3 |
Refseq ORF | 1488 |
Summary | The protein encoded by this gene belongs to a family of glycohydrolytic enzymes, which remove terminal sialic acid residues from various sialo derivatives, such as glycoproteins, glycolipids, oligosaccharides, and gangliosides. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Nov 2009] |
Protein Pathways | Other glycan degradation, Sphingolipid metabolism |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3−/−) mice
,null,
American Journal of Physiology - Lung Cellular and Molecular Physiology
,PubMed ID 31617733
[NEU4]
|
Sialidase inhibitors attenuate pulmonary fibrosis in a mouse model
,Karhadkar, TR;Pilling, D;Cox, N;Gomer, RH;,
Sci Rep
,PubMed ID 29118338
[NEU4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409058 | NEU4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409058 | Transient overexpression lysate of sialidase 4 (NEU4), transcript variant 1 |
CNY 3,080.00 |
|
PH303948 | NEU4 MS Standard C13 and N15-labeled recombinant protein (NP_542779) |
CNY 19,520.00 |