IGFBP6 (NM_002178) Human Recombinant Protein
CAT#: TP304060
Recombinant protein of human insulin-like growth factor binding protein 6 (IGFBP6), 20 µg
View other "IGFBP6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204060 protein sequence
Red=Cloning site Green=Tags(s) MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002169 |
Locus ID | 3489 |
UniProt ID | P24592 |
Refseq Size | 980 |
Cytogenetics | 12q13.13 |
Refseq ORF | 720 |
Synonyms | IBP6 |
Summary | IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400790 | IGFBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400790 | Transient overexpression lysate of insulin-like growth factor binding protein 6 (IGFBP6) |
CNY 3,080.00 |
|
PH304060 | IGFBP6 MS Standard C13 and N15-labeled recombinant protein (NP_002169) |
CNY 19,520.00 |