PP1C gamma (PPP1CC) (NM_002710) Human Recombinant Protein
CAT#: TP304158
Recombinant protein of human protein phosphatase 1, catalytic subunit, gamma isoform (PPP1CC), 20 µg
View other "PP1C gamma" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204158 protein sequence
Red=Cloning site Green=Tags(s) MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYY DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC KRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD KDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002701 |
Locus ID | 5501 |
UniProt ID | P36873 |
Refseq Size | 2526 |
Cytogenetics | 12q24.11 |
Refseq ORF | 969 |
Synonyms | PP-1G; PP1C; PPP1G |
Summary | The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419153 | PPP1CC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419153 | Transient overexpression lysate of protein phosphatase 1, catalytic subunit, gamma isoform (PPP1CC) |
CNY 3,080.00 |
|
PH304158 | PPP1CC MS Standard C13 and N15-labeled recombinant protein (NP_002701) |
CNY 19,520.00 |
|
TP720571 | Recombinant protein of human protein phosphatase 1, catalytic subunit, gamma isoform (PPP1CC) |
CNY 3,140.00 |
其它PP1C gamma产品