SULT2B1 (NM_177973) Human Recombinant Protein
CAT#: TP304478
Recombinant protein of human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, 20 µg
View other "SULT2B1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204478 protein sequence
Red=Cloning site Green=Tags(s) MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS PSPGQASETPHPRPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_814444 |
Locus ID | 6820 |
UniProt ID | O00204 |
Refseq Size | 1228 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1095 |
Synonyms | ARCI14; HSST2 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Pathways | Androgen and estrogen metabolism, Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406066 | SULT2B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406066 | Transient overexpression lysate of sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2 |
CNY 3,080.00 |
|
PH304478 | SULT2B1 MS Standard C13 and N15-labeled recombinant protein (NP_814444) |
CNY 19,520.00 |
|
TP710313 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720859 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2 |
CNY 1,800.00 |
其它SULT2B1产品