PYCR2 (NM_013328) Human Recombinant Protein
CAT#: TP304525
Recombinant protein of human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), 20 µg
View other "PYCR2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204525 protein sequence
Red=Cloning site Green=Tags(s) MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037460 |
Locus ID | 29920 |
UniProt ID | Q96C36, A0A0S2Z5U6 |
Refseq Size | 1771 |
Cytogenetics | 1q42.12 |
Refseq ORF | 960 |
Synonyms | HLD10; P5CR2 |
Summary | This gene belongs to the pyrroline-5-carboxylate reductase family. The encoded mitochondrial protein catalyzes the conversion of pyrroline-5-carboxylate to proline, which is the last step in proline biosynthesis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012] |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402246 | PYCR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402246 | Transient overexpression lysate of pyrroline-5-carboxylate reductase family, member 2 (PYCR2) |
CNY 3,080.00 |
|
PH304525 | PYCR2 MS Standard C13 and N15-labeled recombinant protein (NP_037460) |
CNY 19,520.00 |