RBP4 (NM_006744) Human Recombinant Protein
CAT#: TP304635
Recombinant protein of human retinol binding protein 4, plasma (RBP4), 20 µg
View other "RBP4" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204635 protein sequence
Red=Cloning site Green=Tags(s) MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006735 |
Locus ID | 5950 |
UniProt ID | P02753 |
Refseq Size | 941 |
Cytogenetics | 10q23.33 |
Refseq ORF | 603 |
Synonyms | MCOPCB10; RDCCAS |
Summary | This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402016 | RBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402016 | Transient overexpression lysate of retinol binding protein 4, plasma (RBP4) |
CNY 3,080.00 |
|
PH304635 | RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735) |
CNY 19,520.00 |
|
TP720147 | Recombinant protein of human retinol binding protein 4, plasma (RBP4) |
CNY 3,140.00 |