SERPINA10 (NM_016186) Human Recombinant Protein
CAT#: TP304642
Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 (SERPINA10), transcript variant 1, 20 µg
View other "SERPINA10" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204642 representing NM_016186
Red=Cloning site Green=Tags(s) MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMA SRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGL LPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYIN KETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFD KNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHE LLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPF HFMIYEETSGMLLFLGRVVNPTLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057270 |
Locus ID | 51156 |
UniProt ID | Q9UK55 |
Refseq Size | 2466 |
Cytogenetics | 14q32.13 |
Refseq ORF | 1332 |
Synonyms | PZI; ZPI |
Summary | The protein encoded by this gene belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations in this gene are associated with venous thrombosis. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414137 | SERPINA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420280 | SERPINA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY414137 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 (SERPINA10), transcript variant 1 |
CNY 3,080.00 |
|
LY420280 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 (SERPINA10), transcript variant 2 |
CNY 4,840.00 |
|
PH304642 | SERPINA10 MS Standard C13 and N15-labeled recombinant protein (NP_057270) |
CNY 19,520.00 |
|
TP721047 | Purified recombinant protein of Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 (SERPINA10), transcript variant 1 |
CNY 3,140.00 |
其它SERPINA10产品