AKR1C4 (NM_001818) Human Recombinant Protein
CAT#: TP304731
Recombinant protein of human aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) (AKR1C4), 20 µg
View other "AKR1C4" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204731 protein sequence
Red=Cloning site Green=Tags(s) MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIA DGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFD TVDLSATWEVMEKCKDAGLAKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKD IVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIREN IQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001809 |
Locus ID | 1109 |
UniProt ID | P17516 |
Refseq Size | 1192 |
Cytogenetics | 10p15.1 |
Refseq ORF | 969 |
Synonyms | 3-alpha-HSD; C11; CDR; CHDR; DD-4; DD4; HAKRA |
Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the bioreduction of chlordecone, a toxic organochlorine pesticide, to chlordecone alcohol in liver. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Primary bile acid biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419725 | AKR1C4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419725 | Transient overexpression lysate of aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) (AKR1C4) |
CNY 3,080.00 |
|
PH304731 | AKR1C4 MS Standard C13 and N15-labeled recombinant protein (NP_001809) |
CNY 19,520.00 |
|
TP720536 | Recombinant protein of human aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) (AKR1C4) |
CNY 3,140.00 |