Solute carrier family 22 member 18 (SLC22A18) (NM_183233) Human Recombinant Protein
CAT#: TP304889
Recombinant protein of human solute carrier family 22, member 18 (SLC22A18), transcript variant 2, 20 µg
View other "Solute carrier family 22 member 18" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204889 protein sequence
Red=Cloning site Green=Tags(s) MQGARAPRDQGQSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYLSRKLGLDSIAFGYLQTTFGV LQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVI TDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFTCIPASTKGAK TDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVASNCPTGLFMVMFSIISMDFFQLEAAQAGYLM SFFGLLQMVTQGLVIGQLSSHFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQVAINTLVLLVLWRKPMPQRK DKVR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899056 |
Locus ID | 5002 |
UniProt ID | Q96BI1 |
Refseq Size | 1563 |
Cytogenetics | 11p15.4 |
Refseq ORF | 1272 |
Synonyms | BWR1A; BWSCR1A; HET; IMPT1; ITM; ORCTL2; p45-BWR1A; SLC22A1L; TSSC5 |
Summary | This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is imprinted, with preferential expression from the maternal allele. Mutations in this gene have been found in Wilms' tumor and lung cancer. This protein may act as a transporter of organic cations, and have a role in the transport of chloroquine and quinidine-related compounds in kidney. Several alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403653 | SLC22A18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419259 | SLC22A18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY403653 | Transient overexpression lysate of solute carrier family 22, member 18 (SLC22A18), transcript variant 2 |
CNY 3,080.00 |
|
LY419259 | Transient overexpression lysate of solute carrier family 22, member 18 (SLC22A18), transcript variant 1 |
CNY 4,840.00 |
|
PH304889 | SLC22A18 MS Standard C13 and N15-labeled recombinant protein (NP_899056) |
CNY 19,520.00 |
其它Solute carrier family 22 member 18产品