p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein

CAT#: TP304895

Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, 20 µg

Size: 20 ug 100 ug 1 mg



  View other "p15 INK4b" proteins (7)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (2)
CDKN2B (p15 INK4b) mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
    • 100 ul

CNY 1,999.00
CNY 2,700.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204895 representing NM_004936
Red=Cloning site Green=Tags(s)

MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 14.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_004927
Locus ID 1030
UniProt ID P42772
Refseq Size 3878
Cytogenetics 9p21.3
Refseq ORF 414
Synonyms CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Summary This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...