USF1 (NM_007122) Human Recombinant Protein
CAT#: TP304915
Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1, 20 µg
View other "USF1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204915 protein sequence
Red=Cloning site Green=Tags(s) MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009053 |
Locus ID | 7391 |
UniProt ID | P22415 |
Refseq Size | 1830 |
Cytogenetics | 1q23.3 |
Refseq ORF | 930 |
Synonyms | bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF |
Summary | This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404129 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416182 | USF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404129 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 |
CNY 3,080.00 |
|
LY416182 | Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1 |
CNY 3,080.00 |
|
PH304915 | USF1 MS Standard C13 and N15-labeled recombinant protein (NP_009053) |
CNY 19,520.00 |
|
PH319106 | USF1 MS Standard C13 and N15-labeled recombinant protein (NP_996888) |
CNY 19,520.00 |
|
TP319106 | Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2, 20 µg |
CNY 2,900.00 |