TWIST2 (NM_057179) Human Recombinant Protein
CAT#: TP305006M
Recombinant protein of human twist homolog 2 (Drosophila) (TWIST2), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205006 protein sequence
Red=Cloning site Green=Tags(s) MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER LSYAFSVWRMEGAWSMSASH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_476527 |
Locus ID | 117581 |
UniProt ID | Q8WVJ9 |
Refseq Size | 1186 |
Cytogenetics | 2q37.3 |
Refseq ORF | 480 |
Synonyms | AMS; BBRSAY; bHLHa39; DERMO1; FFDD3; SETLSS |
Summary | The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found. [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |