CCDC12 (NM_144716) Human Recombinant Protein
CAT#: TP305023
Recombinant protein of human coiled-coil domain containing 12 (CCDC12), 20 µg
View other "CCDC12" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205023 protein sequence
Red=Cloning site Green=Tags(s) MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLK KRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIR ERLKGQEDSLASAVDAATEQKTCDSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653317 |
Locus ID | 151903 |
UniProt ID | J3KR35 |
Refseq Size | 1035 |
Cytogenetics | 3p21.31 |
Refseq ORF | 498 |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408166 | CCDC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408166 | Transient overexpression lysate of coiled-coil domain containing 12 (CCDC12) |
CNY 3,080.00 |
|
PH305023 | CCDC12 MS Standard C13 and N15-labeled recombinant protein (NP_653317) |
CNY 19,520.00 |