EDIL3 (NM_005711) Human Recombinant Protein
CAT#: TP305282
Recombinant protein of human EGF-like repeats and discoidin I-like domains 3 (EDIL3), 20 µg
View other "EDIL3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205282 protein sequence
Red=Cloning site Green=Tags(s) MKRSVAVWLLVGLSLSVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEE EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVAN YSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAEN DRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTP YANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFT WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005702 |
Locus ID | 10085 |
UniProt ID | O43854 |
Refseq Size | 4771 |
Cytogenetics | 5q14.3 |
Refseq ORF | 1440 |
Synonyms | DEL1 |
Summary | The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401742 | EDIL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401742 | Transient overexpression lysate of EGF-like repeats and discoidin I-like domains 3 (EDIL3) |
CNY 3,080.00 |
|
PH305282 | EDIL3 MS Standard C13 and N15-labeled recombinant protein (NP_005702) |
CNY 19,520.00 |
|
TP720481 | Recombinant protein of human EGF-like repeats and discoidin I-like domains 3 (EDIL3) |
CNY 3,140.00 |