VILIP1 (VSNL1) (NM_003385) Human Recombinant Protein
CAT#: TP305337
Recombinant protein of human visinin-like 1 (VSNL1), 20 µg
View other "VILIP1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205337 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | WB positive control (PMID: 29283288) |
Reference Data | |
RefSeq | NP_003376 |
Locus ID | 7447 |
UniProt ID | P62760 |
Refseq Size | 2014 |
Cytogenetics | 2p24.2 |
Refseq ORF | 573 |
Synonyms | HLP3; HPCAL3; HUVISL1; VILIP; VILIP-1 |
Summary | This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A novel method for the rapid detection of post-translationally modified visinin-like protein 1 in rat models of brain injury
,Bradley-Whitman, MA;Roberts, KN;Abner, EL;Scheff, SW;Lynn, BC;Lovell, MA;,
Brain Inj
,PubMed ID 29283288
[VSNL1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418720 | VSNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418720 | Transient overexpression lysate of visinin-like 1 (VSNL1) |
CNY 3,080.00 |
|
PH305337 | VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376) |
CNY 19,520.00 |
|
TP720237 | Recombinant protein of human visinin-like 1 (VSNL1) |
CNY 3,140.00 |